Cat: PA1000-687DB

Recombinant Human COPS7A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COPS7A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COPS7A;CSN7A;DERP10;COP9 signalosome complex subunit 7a

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBW8

  • Expression Region

    1-275aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSAEVKVTGQNQEQFLLLAKSAKGAAL ATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYAD YLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQ LEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEW CVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAA AAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COPS7A is a member of the COP9 signalosome (CSN) complex, which plays a crucial role in various cellular processes, including protein degradation, cell cycle regulation, and gene expression. The CSN complex is composed of eight subunits, among which COPS7A is known for its deubiquitinating activity, critical for maintaining protein homeostasis and regulating signal transduction pathways. Research in recent years has highlighted the importance of COPS7A in various diseases, particularly cancer, where dysregulation of the CSN complex can lead to aberrant protein accumulation and tumorigenesis. Furthermore, studies have indicated that COPS7A may influence the stability of key oncogenes and tumor suppressors, thereby impacting cancer progression. Understanding the functional mechanisms of COPS7A, including its interactions with other cellular proteins and its role in the CSN complex, could provide valuable insights into targeted therapeutic strategies. The recombinant expression of COPS7A enables researchers to study its biochemical properties, structural characteristics, and potential interactions, facilitating the advancement of knowledge in cancer biology and therapeutic development. In summary, the research on COPS7A recombinant protein is pivotal for elucidating its role in cellular signaling pathways and its implications in cancer, paving the way for potential innovations in targeted cancer therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US