Analytical Data
-
Gene name
CCR2
- Application
-
Alternative Names
CCR2；CMKBR2；C-C chemokine receptor type 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41597
-
Expression Region
1-42aa
-
AA Sequence
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCR2 (C-C chemokine receptor type 2) is a crucial receptor in the immune system, involved in the recruitment of monocytes and other immune cells to sites of inflammation, making it a key player in various pathological conditions, including cardiovascular diseases, autoimmune disorders, and cancer. Research on CCR2 has gained momentum due to its potential as a therapeutic target for inflammatory and fibrotic diseases. Recombinant CCR2 proteins are vital for studying the structure-function relationships of this receptor, understanding its signaling pathways, and discovering novel drug candidates that can modulate its activity. The use of recombinant techniques allows for the production of purified CCR2 proteins, enabling detailed investigations of their biochemical properties and interactions with ligands. Consequently, CCR2 recombinant proteins serve not only as essential tools for elucidating the roles of this receptor in disease but also as potential platforms for developing targeted therapies that could benefit patients suffering from a range of inflammatory conditions. The ongoing research into CCR2 and its recombinant variants positions this receptor as a promising target in the field of immunology and pharmacology, highlighting the importance of continued exploration into its molecular mechanisms and therapeutic implications.
