Cat: PA1000-9372

Recombinant Human CCR10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCR10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCR10;GPR2;C-C chemokine receptor type 10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P46092

  • Expression Region

    1-362aa

  • AA Sequence

    MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLT VAALGLAGNGLVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAA GALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYVAIARALPAGP RPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCRLIFPEGLT QTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGPERRRALRVVV ALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCS APTETHSLSWDN

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCR10, a member of the CC chemokine receptor family, plays a pivotal role in the immune system by mediating the trafficking of lymphocytes, particularly in the context of mucosal immunity. This receptor is primarily expressed on lymphocytes and is involved in directing these cells to various tissues, including the skin and mucosal surfaces, where they participate in immune responses against infections and inflammation. Research into CCR10 has gained momentum due to its potential implications in various diseases, including autoimmune disorders, allergies, and cancers, where aberrant expression or function of this receptor may contribute to disease progression. The recombinant production of CCR10 protein is crucial for elucidating its structural and functional characteristics, as well as for developing therapeutic strategies that target CCR10-mediated pathways. Understanding the signaling mechanisms and interactions of CCR10 could lead to novel interventions for conditions characterized by dysregulated immune responses. As CCR10 continues to be a focus of immunological research, the study of its recombinant protein provides insights into its biological significance and opens avenues for innovative treatments in the context of immunotherapy and targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US