Analytical Data
-
Gene name
PAG1
- Application
-
Alternative Names
PAG1；CBP；PAG；PhosphoProtein associated with glycosphingolipid-enriched microdomains 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NWQ8
-
Expression Region
38-432aa
-
AA Sequence
SSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL
-
Molecular Weight
50.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PAG1 (Phosphoprotein associated with glycosphingolipid-enriched microdomains 1) is a multi-functional protein heavily researched for its role in various cellular processes, particularly in relation to cancer and immune signaling. It is primarily expressed in immune cells, where it is involved in the regulation of cell signaling pathways that control cell growth, differentiation, and death. Studies have indicated that PAG1 can act as a negative regulator of several signaling pathways, including the T-cell receptor signaling pathway, thus playing a crucial role in maintaining cellular homeostasis. In cancer research, PAG1's involvement in tumor progression and metastasis has garnered significant interest, as altered expression levels of PAG1 have been associated with various malignancies, including breast and colon cancer. The development of recombinant PAG1 proteins allows for detailed studies of its structure-function relationships and interactions with other signaling molecules, providing insights into its biological roles. Furthermore, understanding PAG1's molecular mechanisms could lead to potential therapeutic strategies targeting its pathway, aiming to enhance immune responses or inhibit tumor growth. Overall, research on PAG1 is pivotal for unraveling the complexities of cell signaling in health and disease, thereby fostering advancements in both basic biology and clinical applications.
