Analytical Data
-
Gene name
MARCKS
- Application
-
Alternative Names
MARCKS；MLP；MRP；MARCKS-related Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29966
-
Expression Region
2-65aa
-
AA Sequence
GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAE SGAKEELQANGSAP
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MARCKS (Myristoylated Alanine-Rich C Kinase Substrate) protein is a highly conserved protein that plays a crucial role in various cellular processes, including cell motility, signaling, and membrane dynamics. Its unique structure features a myristoylation site that allows it to associate with cell membranes and an alanine-rich domain that interacts with phospholipids, which is pivotal for its function. The protein is implicated in several physiological processes and has been linked to various diseases, such as cancer, neurodegenerative disorders, and cardiovascular diseases. Research on MARCKS has gained traction due to its potential as a biomarker and therapeutic target. Specifically, scientists are investigating the mechanisms by which MARCKS regulates actin dynamics and cell signaling pathways. The ability of MARCKS to influence cell behavior makes it an attractive candidate for understanding disease mechanisms and developing innovative therapeutic strategies. Recent studies have focused on its role in membrane trafficking, its interaction with other signaling molecules, and how its dysregulation can lead to pathologies. Furthermore, the development of recombinant MARCKS proteins allows for in-depth studies of its functionalities and interactions in vitro, providing insights that could lead to new interventions in MARCKS-related diseases. Overall, the exploration of MARCKS and its recombinant forms represents a promising avenue for enhancing our understanding of cellular communication and developing novel therapeutic approaches.
