Cat: PA1000-625DB

Recombinant Human CIRBP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CIRBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CIRBP;A18HNRNP;CIRP;Cold-inducible RNA-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14011

  • Expression Region

    1-172aa

  • AA Sequence

    MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG FVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGG RGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGG YSDRSSGGSYRDSYDSYATHNE

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CIRBP (Cold-Inducible RNA-Binding Protein) has garnered attention in recent years due to its critical role in cellular responses to stress, particularly in low-temperature conditions. As a highly conserved protein, CIRBP is involved in the regulation of gene expression and the stability of mRNA, impacting cellular functions such as differentiation, proliferation, and apoptosis. In various studies, CIRBP has been implicated in several physiological and pathological processes, including cancer progression, neuroprotection, and cellular survival during stress. Its ability to bind RNA and modulate the translation of specific mRNAs allows CIRBP to orchestrate a complex network of stress-response genes. Furthermore, the protein's expression levels are known to fluctuate under different environmental conditions, making it a key player in the adaptation of cells to stress. Understanding CIRBP’s mechanisms of action can provide valuable insights into its potential as a therapeutic target in diseases associated with cellular stress responses, such as cancer and neurodegenerative disorders. The recombinant expression of CIRBP allows researchers to further investigate its structure-function relationships, interactions with nucleic acids, and overall role in cellular stress management, paving the way for novel intervention strategies in related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US