Analytical Data
-
Gene name
SSTR2
- Application
-
Alternative Names
SSTR2；Somatostatin receptor type 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30874-1
-
Expression Region
1-369aa
-
AA Sequence
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIY FVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLA MQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKS AKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGE SGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKS EKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRL NETTETQRTLLNGDLQTSI
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Somatostatin receptor 2 (SSTR2) is a member of the somatostatin receptor family, which plays a crucial role in various physiological processes, including hormone regulation and cell signaling. SSTR2 is predominantly expressed in the central nervous system and several peripheral tissues, where it modulates neurotransmitter release and cellular proliferation. Its importance in neuroendocrine tumors, particularly in the context of diagnostic imaging and targeted therapies, has spurred significant interest in the development of SSTR2 recombinant proteins for both basic research and clinical applications. By generating these recombinant proteins, researchers aim to elucidate the structural and functional properties of SSTR2, which can aid in understanding its role in disease mechanisms. Moreover, there is a growing focus on utilizing SSTR2 as a therapeutic target, as its activation can inhibit tumor growth and improve treatment outcomes in patients with somatostatin receptor-expressing tumors. The study of SSTR2 recombinant proteins encompasses various methodologies, including protein expression, purification, and characterization, to develop effective ligands and radiotracers that can enhance the specificity and efficacy of SSTR2-targeted therapies. This research not only contributes to the fundamental understanding of receptor biology but also represents a promising avenue for the advancement of targeted treatment strategies in cancer and other pathologies associated with aberrant somatostatin signaling.
