Analytical Data
-
Gene name
CHP
- Application
-
Alternative Names
CHP；CHP；Calcineurin B homologous Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99653
-
Expression Region
1-195aa
-
AA Sequence
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Chlorophyll a/b binding proteins (CHP) are vital components in the photosynthetic apparatus of plants, algae, and some bacteria, playing a crucial role in light harvesting and energy transfer. Research on CHP proteins has gained momentum due to their significance in understanding the efficiency of photosynthesis, which directly influences plant growth and agricultural productivity. The ability to manipulate and enhance CHP proteins has implications for bioengineering crops to withstand environmental stresses and improve yields. Moreover, insights gained from the study of CHP proteins contribute to the broader fields of synthetic biology and renewable energy, particularly in the development of bio-inspired solar energy systems. Recent advancements in structural biology and molecular techniques have enabled researchers to investigate the intricate mechanisms of CHP proteins, paving the way for innovations in crop improvement and sustainable energy solutions. Given the ongoing challenges posed by climate change and global food security, the exploration of CHP proteins is more relevant than ever, as scientists seek to optimize photosynthetic efficiency and develop resilient agricultural systems.
