Analytical Data
-
Gene name
PRSS1
- Application
-
Alternative Names
PRSS1；AAT；PI；Alpha-1-antitrypsin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07477
-
Expression Region
104-206aa
-
AA Sequence
LNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVC
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRSS1, also known as cationic trypsinogen, is a serine protease primarily produced in the pancreas. It plays a crucial role in the digestive process by catalyzing the cleavage of peptide bonds in proteins, facilitating their breakdown into absorbable units. Mutations in the PRSS1 gene have been linked to hereditary pancreatitis, a condition characterized by recurrent inflammation of the pancreas, which can lead to severe complications such as pancreatic cancer. The investigation of recombinant PRSS1 proteins has gained attention in both basic and clinical research due to their potential implications in understanding the mechanisms of pancreatic diseases. Producing PRSS1 in a recombinant form allows for the detailed study of its enzymatic properties, structural characteristics, and interaction with inhibitors. Additionally, recombinant PRSS1 can serve as a valuable tool for developing therapeutic strategies aimed at managing pancreatitis and for screening potential inhibitors that can mitigate the pathological effects of overactive trypsinogen. Understanding the molecular pathways associated with PRSS1 and its enzymatic activity can provide insights into the pathology of pancreatic disorders and open avenues for innovative treatments. Through advancements in protein engineering and recombinant technology, researchers aim to elucidate the functional roles of PRSS1 and develop novel approaches to prevent or treat conditions related to its dysregulation.
