Analytical Data
-
Gene name
PMP22
- Application
-
Alternative Names
PMP22；GAS3；Peripheral myelin Protein 22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01453
-
Expression Region
1-160aa
-
AA Sequence
MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNV HHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITG IFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAWVAFPLALLSG VIYVILRKRE
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PMP22 (Peripheral Myelin Protein 22) is a key player in the formation and maintenance of myelin, the protective sheath surrounding nerve fibers in the peripheral nervous system. Mutations and dysregulation of the PMP22 gene are associated with several hereditary neuropathies, including Charcot-Marie-Tooth disease type 1A (CMT1A), which leads to progressive muscle weakness and sensory loss. Understanding the structural and functional properties of PMP22 is crucial for elucidating the mechanisms underlying these neuropathies. Recombinant PMP22 proteins are used in various research applications to study its role in myelin formation, cellular signaling, and interactions with other myelin-related proteins. Furthermore, the study of PMP22 may pave the way for the development of targeted therapies aimed at ameliorating the symptoms of hereditary neuropathies. Research utilizing recombinant PMP22 proteins helps clarify how variations in this protein affect nerve function and contribute to disease pathology, ultimately guiding diagnostic and therapeutic strategies for affected individuals.
