Analytical Data
-
Gene name
CA3
- Application
-
Alternative Names
CA3；C1orf36；Protein RD3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07451
-
Expression Region
2-260aa
-
AA Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVS YDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSS DDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIG HENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTP PCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPI NNRVVRASFKLEHHHHHH
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CA3 (Carbonic Anhydrase III) is an enzyme predominantly expressed in skeletal muscle and plays a crucial role in maintaining acid-base balance and facilitating molecular transport across membranes. Its primary function is to catalyze the reversible hydration of carbon dioxide, promoting efficient gas exchange and metabolic processes. Research into CA3 has gained prominence due to its implications in various physiological and pathological conditions, including muscle metabolism, exercise performance, and certain diseases like cancer and neurodegenerative disorders. Elevated levels of CA3 have been associated with tumorigenesis, suggesting its potential as a biomarker for cancer diagnosis and prognosis. Additionally, studies have demonstrated that CA3 may influence muscle fatigue and recovery, highlighting its importance in sports science. Understanding the structure-function relationship of CA3 through recombinant protein studies allows researchers to explore its enzymatic properties, regulatory mechanisms, and interaction with other biomolecules, paving the way for therapeutic applications. Moreover, the availability of recombinant CA3 proteins facilitates the development of inhibitors or modulators that could have significant implications in clinical settings, particularly in cancer therapy and muscle-related diseases. Therefore, investigating CA3 in detail not only enhances our comprehension of its biological role but also opens avenues for innovative treatments targeting metabolic dysregulation and other CA3-related pathologies.
