Analytical Data
-
Gene name
ZFHX4
- Application
-
Alternative Names
ZFHX4；Zinc finger homeobox Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86UP3
-
Expression Region
2-93aa
-
AA Sequence
ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNL KTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZFHX4, also known as ZFP-148 or ZEB1, is a member of the Zinc Finger Homeodomain (ZFH) transcription factor family, which is known to play significant roles in various biological processes, including embryonic development, cellular differentiation, and tumorigenesis. Research on ZFHX4 has gained prominence due to its involvement in regulating gene expression during developmental processes and its potential implications in cancer biology, particularly in the context of epithelial-mesenchymal transition (EMT). EMT is a crucial mechanism that allows epithelial cells to acquire migratory and invasive properties, thereby contributing to metastasis in cancer. ZFHX4 functions by binding to specific DNA sequences and modulating the expression of target genes associated with cell proliferation, survival, and migration. Additionally, aberrations in ZFHX4 expression have been linked to various malignancies, making it a potential biomarker and therapeutic target in cancer treatment. Recent advancements in recombinant protein technology have facilitated the production and characterization of ZFHX4, enabling researchers to investigate its structural and functional properties. Understanding the molecular mechanisms underlying ZFHX4's role in different biological contexts could provide valuable insights for developing novel diagnostic and therapeutic strategies for diseases such as cancer. As such, the study of ZFHX4 recombination and its protein products holds promise for enhancing our comprehension of transcriptional regulation and its broader implications in health and disease.
