Cat: PA1000-322DB

Recombinant Human BECN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BECN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BECN1;GT197;Beclin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14457

  • Expression Region

    1-450aa

  • AA Sequence

    MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTA QAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLI GEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDT QLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELED VEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSV ENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEK GKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK

  • Molecular Weight

    78 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BECN1 (Beclin 1) is a crucial protein involved in the regulation of autophagy, a cellular process responsible for degrading and recycling cellular components. It plays a significant role in various physiological and pathological processes, including development, immunity, and cancer. Research has shown that BECN1 is a vital component of the class III phosphatidylinositol 3-kinase (PI3K) complex, which initiates the formation of autophagosomes. Dysregulation of BECN1 is implicated in numerous diseases, particularly cancer, where it often functions as a tumor suppressor. Because of its central role in autophagy and cell survival, BECN1 has emerged as a potential therapeutic target for cancer treatment and neurodegenerative diseases. Recent studies have focused on the structural and functional analysis of BECN1, emphasizing the importance of its interactions with other proteins and lipids. The recombinant expression of BECN1 provides a platform for elucidating its molecular mechanisms and potential as a drug target. Understanding BECN1's role in autophagy and its implications in disease could pave the way for novel therapeutic strategies aimed at manipulating this pathway for clinical benefit. As research advances, the role of BECN1 in both promoting and inhibiting autophagy highlights its complexity and the need for further investigation into its multifaceted functions within cells.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US