Analytical Data
-
Gene name
BCL7C
- Application
-
Alternative Names
BCL7C；B-cell CLL/lymphoma 7 Protein family member C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WUZ0
-
Expression Region
1-217aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAGRTVRAETRSRAKDDIKKVMATIEK VRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSRGRERRGR GASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSP AGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEA PEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BCL7C (B-cell lymphoma 7 protein C) is a member of the BCL7 gene family, which plays a significant role in cellular processes such as cell proliferation, differentiation, and apoptosis. Its involvement in various cancers, particularly hematological malignancies and solid tumors, has drawn significant attention to understanding its molecular mechanisms. Researchers have identified that BCL7C is often implicated in chromosomal rearrangements and translocations, contributing to oncogenesis. The study of BCL7C recombinant protein serves as a crucial tool for elucidating its biological functions and potential therapeutic roles. By producing and characterizing recombinant BCL7C, scientists aim to investigate its interactions with other proteins, its influence on cell cycle regulation, and its impact on tumorigenesis. Furthermore, understanding the structure-function relationship of BCL7C can provide insights into its role in cancer biology and aid in the development of novel strategies for targeted therapies. Overall, the research on BCL7C recombinant protein is essential for unveiling the complexities of cancer mechanisms and identifying potential biomarkers for diagnosis and treatment.
