Analytical Data
-
Gene name
TNFSF9
- Application
-
Alternative Names
TNFSF9；Tumor necrosis factor ligand superfamily member 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41273
-
Expression Region
71-254aa
-
AA Sequence
REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
-
Molecular Weight
48.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF9, also known as 4-1BB ligand, is a member of the tumor necrosis factor (TNF) superfamily that plays a crucial role in immune regulation and T-cell activation. Its interaction with the 4-1BB receptor (CD137) on activated T cells enhances their proliferation, survival, and cytokine production, making TNFSF9 a potential target for cancer immunotherapy. Research has demonstrated that TNFSF9 can boost anti-tumor responses, contributing to the development of effective therapeutic strategies against various malignancies. Additionally, TNFSF9 has shown promise in promoting the generation of memory T cells, which are essential for long-lasting immunity. As a result, scientists are investigating the therapeutic implications of TNFSF9-based products, including recombinant proteins, in combination with other immune checkpoint inhibitors to enhance the outcomes of cancer treatments. Understanding the structure, function, and signaling pathways associated with TNFSF9 will provide valuable insights into its application in clinical settings, potentially leading to novel immunotherapeutic approaches and improved patient outcomes in oncology.
