Analytical Data
-
Gene name
B9D2
- Application
-
Alternative Names
B9D2;MKSR2;B9 domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BPU9
-
Expression Region
1-175aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAEVHVIGQIIGASGFSESSLFCKWGI HTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLH FQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAF VGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B9D2, a member of the B9 protein family, has garnered significant attention in recent research due to its potential involvement in cilia formation and function. Cilia are microscopic hair-like structures that play crucial roles in cell signaling, development, and movement. Dysfunctions in ciliary proteins often lead to various ciliopathies, which are diseases resulting from abnormal cilia function, affecting multiple organ systems. Preclinical studies suggest that B9D2 might be critical for the stability and assembly of ciliary structures, making it a vital player in maintaining cellular homeostasis. Understanding the molecular mechanisms of B9D2 could provide insights into its role in cilia-related disorders and unveil potential therapeutic targets. Furthermore, exploring B9D2's interactions with other ciliary proteins may elucidate its role in cellular signaling pathways and development. Given the implications of ciliary dysfunction in health and disease, research on B9D2 not only enhances our understanding of ciliary biology but also opens avenues for novel interventions in ciliopathies and related conditions.











