Analytical Data
-
Gene name
B2M
- Application
-
Alternative Names
B2M；KIAA0935；Epididymis-specific alpha-mannosidase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61769
-
Expression Region
1-119aa
-
AA Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B2M, or beta-2-microglobulin, is a small protein that plays a crucial role in the immune system by forming a part of the major histocompatibility complex (MHC) class I molecules on cell surfaces. It is essential for presenting endogenous antigens to CD8+ T cells, thus influencing immune responses. The study of B2M, particularly in relation to its recombinant forms, has gained significant interest due to its implications in various diseases, including viral infections, autoimmune disorders, and cancers like multiple myeloma and lymphoma. Alterations in B2M levels can serve as biomarkers for disease progression and prognosis. Moreover, recombinant B2M is being explored for its potential therapeutic applications, including the enhancement of immune responses in vaccines and immunotherapies. Understanding the structure-function relationship of B2M and its interactions with other molecular partners is critical for developing innovative strategies to manipulate immune responses for better clinical outcomes. As research progresses, the implications of B2M in both health and disease continue to be a compelling area of study in immunology and therapeutic development.
