Analytical Data
-
Gene name
ATP5D
- Application
-
Alternative Names
ATP5D；ATP5D；ATP synthase subunit delta. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30049
-
Expression Region
23-168aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAEAAAAPAAASGPNQMSFTFASPTQVFFN GANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSS GSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRA EIQIRIEANEALVKALE
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP5D, a subunit of the ATP synthase complex, plays a crucial role in cellular energy production through oxidative phosphorylation. This protein is part of the F1 sector of the ATP synthase, which synthesizes adenosine triphosphate (ATP) using the proton gradient generated across the inner mitochondrial membrane. Research has indicated that ATP5D not only contributes to ATP synthesis but also has implications in various cellular processes, including regulation of apoptosis and cell proliferation. Mutations or dysregulation of ATP5D have been linked to several diseases, particularly mitochondrial disorders and certain types of cancer, highlighting its significance in maintaining cellular energy homeostasis and overall mitochondrial function. Recombinant ATP5D protein has become a focal point for experimental studies, enabling researchers to elucidate its structural and functional properties. The production and characterization of ATP5D in recombinant systems have facilitated a deeper understanding of its role in mitochondrial bioenergetics and its potential as a therapeutic target. Additionally, the investigation of ATP5D interactions with other subunits of ATP synthase and its impact on enzyme activity and assembly provides insights into the mechanisms of ATP production and mitochondrial dynamics. As research progresses, the exploration of ATP5D as a biomarker for disease and a target for drug development continues to expand, underscoring its relevance in both basic and clinical research settings.
