Analytical Data
-
Gene name
ATP1B3
- Application
-
Alternative Names
ATP1B3；Sodium/potassium-transporting ATPase subunit beta-3
-
Species
Human
-
Source
E. coli
-
Tag
GST tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54709
-
Expression Region
1-279aa
-
AA Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFL AALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDP TSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISL LQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPN VAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVEC KIDGSANLKSQDDRDKFLGRVMFKITARA
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP1B3, a member of the ATPase family, encodes the beta subunit of the enzyme Na+/K+ ATPase, which is crucial for maintaining ion gradients across cell membranes. This enzyme plays a vital role in various physiological processes, including nutrient absorption, cellular signaling, and neurotransmission. Deficiencies or mutations in ATP1B3 have been linked to several diseases, particularly in the context of cardiac and neurological conditions, highlighting its importance in health and disease. Recent research has focused on the recombinant expression of ATP1B3 to facilitate detailed studies of its structure and function. By producing ATP1B3 as a recombinant protein, researchers aim to better understand its interactions with the alpha subunit and other cellular components, as well as its role in ion transport regulation. This research not only sheds light on the underlying mechanisms of diseases associated with ATP1B3 dysregulation but also opens up potential avenues for the development of therapeutic interventions targeting this critical enzyme. Given the essential functions of ATP1B3, understanding its properties at a molecular level is expected to provide insights into novel strategies for treating disorders linked to its dysfunction.
