Analytical Data
-
Gene name
FCN3
- Application
-
Alternative Names
FCN3；FCNH；HAKA1；Ficolin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75636
-
Expression Region
1-288aa
-
AA Sequence
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAP GSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCL PEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEF WLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLAL GKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRS NLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Recombinant FCN3 protein, derived from the ficolin-3 gene, has gained significant attention in immunology and infectious disease research due to its essential role in innate immunity. Ficolin-3, a collagen-like lectin, is primarily produced by the liver and plays a crucial role in the opsonization of pathogens and activation of the complement system. It binds to various microbial surfaces, facilitating their recognition and elimination by immune cells. Moreover, FCN3 is implicated in the pathogenesis of several diseases, including infections, autoimmune disorders, and cancer. The production of recombinant FCN3 protein allows researchers to study its biochemical properties and functional dynamics in vitro and in vivo. By examining the interactions between FCN3 and pathogens, as well as its regulatory effects on immune responses, scientists aim to unravel its therapeutic potential and clarify its role in disease mechanisms. Understanding the structure-function relationship of recombinant FCN3 may also lead to the development of novel diagnostic tools and therapeutic interventions, enhancing our ability to combat infectious diseases and modulate immune responses. Thus, ongoing research into recombinant FCN3 not only contributes to basic immunological knowledge but also holds promise for clinical applications in improving health outcomes.
