Cat: PA1000-263DB

Recombinant Human ATG3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ATG3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ATG3;APG3;APG3L;;Ubiquitin-like-conjugating enzyme ATG3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NT62

  • Expression Region

    1-314aa

  • AA Sequence

    MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHC PTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE DDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDED EGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTY DLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENH PHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYL LIFLKFVQAVIPTIEYDYTR HFTM

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ATG3, a crucial component of the autophagy machinery, plays a significant role in the formation of autophagosomes, which are vital for cellular degradation and recycling processes. Autophagy is an essential cellular process that helps maintain homeostasis by removing damaged organelles and misfolded proteins, thereby preventing the development of various diseases, including neurodegenerative disorders, cancer, and infections. Research on ATG3 has gained momentum due to its involvement in the ubiquitin-like conjugation systems that facilitate the lipidation of LC3, a core protein in autophagosome formation. Understanding the functional dynamics of ATG3 offers insights into the mechanisms underlying autophagy regulation, cellular stress responses, and the potential development of therapeutic strategies targeting autophagy-dependent pathways. Given that dysregulation of autophagy is associated with several diseases, the study of ATG3 and its interactions with other autophagy-related proteins is pivotal in deciphering its role in health and disease. Current studies are exploring the structural characteristics of ATG3, its regulatory mechanisms, and its potential as a target for drug development in diseases where autophagy is altered. This area of research not only enhances our understanding of fundamental cellular processes but also holds promise for innovative therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US