Cat: PA1000-261DB

Recombinant Human ATF4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ATF4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ATF4;CREB2;TXREB;Cyclic AMP-dependent transcription factor ATF-4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P18848

  • Expression Region

    1-351aa

  • AA Sequence

    MHHHHHHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQN PTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVF DKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFV QMMTAKGSHMTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVA KHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDL KEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPI GHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEG DRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGS PNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTA ATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEV RKARGKKRVP

  • Molecular Weight

    57 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ATF4 (Activating Transcription Factor 4) is a crucial transcription factor that plays a significant role in the cellular response to various stress conditions, including amino acid deprivation, oxidative stress, and endoplasmic reticulum (ER) stress. It is encoded by the ATF4 gene and is part of the ATF/CREB family of proteins. Under stress conditions, ATF4 is induced through the integrated stress response (ISR), primarily via phosphorylation of eIF2α, leading to changes in gene expression that promote adaptation, survival, and apoptosis in cells. Research has shown that ATF4 is not only pivotal in the stress response but also involved in metabolic regulation and differentiation processes. Notably, it has implications in various diseases, including cancer, neurodegenerative disorders, and metabolic syndromes, highlighting its importance in both basic and translational research. Scientists have increasingly focused on ATF4 reconstitution studies to better understand its functional mechanisms and regulatory roles. Recent advances in molecular techniques have facilitated the study of ATF4 protein, its post-translational modifications, and its interactions with other proteins within the cellular milieu. These studies aim to unravel the complexities of its function, with the potential for therapeutic interventions targeting ATF4 signaling pathways. Understanding ATF4's role in health and disease can provide valuable insights into novel strategies for disease management and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US