Analytical Data
-
Gene name
ARL5B
- Application
-
Alternative Names
ARL5B；ARL8；ADP-ribosylation factor-like Protein 5B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96KC2
-
Expression Region
1-299aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGLIFAKLWSLFCNQEHKVIIVGLDNAGKT TILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTY YSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMK GCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARL5B (ADP-ribosylation factor-like protein 5B) is a member of the ARF family of small GTPases, which play crucial roles in intracellular trafficking, cytoskeletal dynamics, and cellular signaling pathways. Research has highlighted that ARL5B is involved in the regulation of various cellular processes, including endosomal transport and vesicle formation. The protein is predominantly localized in the cytoplasm and has been implicated in the modulation of the Golgi apparatus and endosomes, which are vital for cellular homeostasis and communication. Recent studies have suggested that ARL5B may also have a role in the pathogenesis of certain diseases, such as cancer, by affecting cell proliferation and migration. Given its significance in both normal cellular functions and disease mechanisms, there is an increasing interest in understanding the biochemical properties and functional mechanisms of ARL5B. Recombinant ARL5B proteins have been generated to study their biochemical properties, interactions with other cellular components, and regulatory mechanisms. These studies are essential for uncovering the potential therapeutic targets associated with ARL5B and its pathways, thereby advancing our knowledge of its role in health and disease. Such investigations not only contribute to the fundamental understanding of ARL5B function but also open avenues for developing novel strategies in treating ARL5B-related pathologies.
