Analytical Data
-
Gene name
ARL15
- Application
-
Alternative Names
ARL15；ARFRP2；ADP-ribosylation factor-like Protein 15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N1W3
-
Expression Region
1-204aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSDLRITEAFLYMDYLCFRALCCKGPPPAR PEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNV KELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHP QLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDM DALKDSFSQLINLLEEKDHEAVRM
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARL15 (ADP-ribosylation factor-like 15) is a member of the ARF protein family, which is crucial for various cellular processes including vesicle transport, cell proliferation, and differentiation. Research into ARL15 has gained momentum due to its potential roles in metabolic regulation and its association with obesity and insulin resistance. Studies have indicated that ARL15 may influence glucose homeostasis and adipocyte differentiation, making it a target of interest for understanding mechanisms underlying metabolic disorders. Furthermore, recent genomic analyses have identified variations in the ARL15 gene linked to body mass index (BMI) and other metabolic traits, suggesting that ARL15 could function as a key regulator in energy balance. The exploration of ARL15 as a recombinant protein aims to elucidate its functional mechanisms, interaction partners, and downstream signaling pathways, providing insights into its potential as a therapeutic target for obesity and related metabolic diseases. As such, characterizing ARL15 at a molecular level can open new avenues for developing interventions to tackle the increasing global prevalence of metabolic syndromes.
