Cat: PA1000-9014

Recombinant Human ARC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ARC;KIAA0278;Activity-regulated cytoskeleton-associated Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7LC44

  • Expression Region

    1-396aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMELDHRTSGGLHAYPGPRGGQVAKPNVILQ IGKCRAEMLEHVRRTHRHLLAEVSKQVERELKGLHRSVGKLESNLDGYVP TSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVFYRLERWADRL ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQ VGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLS REAIQRELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQ PKLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPAGPHLPVEDEAETLT PAPNSESVASDRTQPE

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARC (Activity-Regulated Cytoskeleton-associated Protein) is a neuronal activity-regulated protein that plays a crucial role in synaptic plasticity and memory formation. Its significance has been highlighted in various studies linking it to the mechanisms underlying learning and memory at the synaptic level. Research has shown that ARC is upregulated in response to synaptic stimulation and is involved in the internalization of AMPA receptors, which are essential for synaptic transmission. Disruptions in ARC function have been associated with neurodevelopmental and neurodegenerative disorders, making it a target of increasing interest in both basic neuroscience and therapeutic research. The ability of ARC to influence synaptic dynamics provides insights into the molecular mechanisms of cognitive function and offers potential avenues for the development of interventions in conditions where cognitive function is impaired. As studies progress, understanding the precise molecular interactions and signaling pathways involving ARC is expected to enhance our comprehension of synaptic behavior and its implications for learning and memory processes. These insights may pave the way for novel therapeutic strategies aimed at manipulating ARC activity to ameliorate cognitive deficits associated with various neurological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US