Analytical Data
-
Gene name
CDC25
- Application
-
Alternative Names
CDC25；CDC25；GNRP；GRF1；Ras-specific guanine nucleotide-releasing factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30307
-
Expression Region
1-473aa
-
AA Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
-
Molecular Weight
57.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of CDC25 recombinant protein is pivotal in understanding cell cycle regulation and its implications in cancer biology. CDC25, or cell division cycle 25, is a family of dual-specificity phosphatases that play a critical role in activating cyclin-dependent kinases (CDKs) by dephosphorylating them, thereby facilitating cell cycle progression. The dysregulation of CDC25 activity is associated with various cancers, making it a significant target for therapeutic interventions. Research into recombinant forms of CDC25 aims to elucidate its biochemical properties, regulatory mechanisms, and interactions with other cell cycle components. By producing CDC25 proteins through recombinant DNA technology, scientists can investigate specific aspects of its function and develop potential inhibitors that could serve as cancer treatments. Furthermore, understanding the structural characteristics of CDC25 can aid in the design of drugs that selectively target its activity, providing a foundation for novel cancer therapies. As such, the investigation of CDC25 recombinant proteins is not only crucial for fundamental biology but also holds promise for clinical applications in oncology.
