Analytical Data
-
Gene name
WNT7B
- Application
-
Alternative Names
WNT7B；Protein Wnt-7b
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56706
-
Expression Region
241-349aa
-
AA Sequence
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQ GRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCS ERTEVFTCK
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WNT7B is a member of the WNT family of signaling proteins, which play crucial roles in various developmental processes, including cell proliferation, differentiation, and tumorigenesis. Research has highlighted the importance of WNT7B in the regulation of embryonic development and its potential implications in cancer biology, particularly in breast and ovarian cancers. Given its involvement in the Wnt signaling pathway, which is critical for cell communication, understanding WNT7B's structure and function could unveil new therapeutic targets for cancer treatment. Recombinant WNT7B protein can be produced through recombinant DNA technology, enabling detailed studies of its biological activity and mechanisms. Investigating the effects of WNT7B in various cellular contexts can provide insights into its role in tissue homeostasis and disease. Moreover, the creation of recombinant WNT7B opens avenues for drug discovery and the development of WNT pathway modulators, making it an important focus in both fundamental and applied biomedical research.
