Analytical Data
-
Gene name
ARF1
- Application
-
Alternative Names
ARF1；ADP-ribosylation factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P84077
-
Expression Region
2-181aa
-
AA Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGF NVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVN EAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHR NWYIQATCATSGDGLYEGLDWLSNQLRNQK
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARF1 (ADP-ribosylation factor 1) is a member of the ARF family of small GTPases, playing a crucial role in intracellular membrane trafficking and cytoskeletal dynamics. It is particularly involved in the formation of COPI-coated vesicles, which are essential for retrograde transport from the Golgi apparatus to the endoplasmic reticulum. The regulation of ARF1 activity, through GDP-GTP cycling, is vital for maintaining cellular homeostasis and facilitating various cellular processes, including endocytosis and exocytosis. Research on ARF1 has gained traction due to its implications in various diseases, including cancer and neurodegenerative disorders, where dysregulation of membrane trafficking is often observed. The recombination and characterization of ARF1 proteins have enabled scientists to dissect its functional mechanisms and interactions with downstream effectors. Utilizing recombinant ARF1 proteins allows for the exploration of its GTPase activity, binding partners, and the biochemical pathways it influences. As a result, the study of ARF1 has provided insights into fundamental cellular processes and highlighted its potential as a therapeutic target in diseases linked to membrane trafficking anomalies. Understanding ARF1's role and regulation offers promising avenues for developing strategies to manipulate this pathway for therapeutic benefits.
