Cat: PA1000-8999

Recombinant Human WNT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WNT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WNT3;INT4;Proto-oncogene Wnt-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56703

  • Expression Region

    1-355aa

  • AA Sequence

    MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPG LVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAI FGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPG EGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILD HMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHR ESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYD VHTCK

  • Molecular Weight

    66 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WNT3 is a key member of the Wnt signaling pathway, which plays a crucial role in various developmental processes, including cell proliferation, differentiation, and fate determination. The Wnt pathway is essential for embryonic development and has been implicated in the regulation of stem cell activity and the maintenance of pluripotency. Research into WNT3 has gained significance due to its involvement in various cancers and degenerative diseases, where aberrations in Wnt signaling can lead to uncontrolled cell growth and tumorigenesis. The production and characterization of recombinant WNT3 protein provide a valuable tool for studying its biological functions and the molecular mechanisms underlying its activity. This recombinant protein can be used in various assays to investigate its roles in cellular contexts, such as stem cell differentiation, tissue regeneration, and the modulation of immune responses. Additionally, understanding the structure and function of WNT3 can aid in the development of therapeutic strategies, including Wnt pathway inhibitors or activators, to treat diseases associated with dysregulated Wnt signaling. Overall, the study of WNT3 recombinant protein has the potential to contribute significantly to regenerative medicine, cancer therapy, and our overall understanding of developmental biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US