Cat: PA1000-8998

Recombinant Human WNT2B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WNT2B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WNT2B;WNT13;Protein Wnt-2b

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q93097

  • Expression Region

    1-391aa

  • AA Sequence

    MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL TLPARVDTSWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGA REWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGV VHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAK AFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRT CWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVT RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WNT2B is a member of the WNT gene family, which encodes for secreted signaling proteins that play crucial roles in various biological processes, including embryonic development, cell proliferation, and differentiation. The WNT signaling pathway is vital for maintaining cellular homeostasis and regulating stem cell functions. Dysregulation of WNT signaling has been implicated in several diseases, including cancer, making WNT2B a candidate for therapeutic interventions. Research into WNT2B recombinant protein focuses on understanding its specific functions and interactions within the WNT signaling pathway. By producing and characterizing this protein, scientists aim to elucidate its role in regulating stem cell behavior and tissue development. Additionally, studying WNT2B can provide insights into its potential as a biomarker for diseases associated with WNT pathway abnormalities. The recombinant production of WNT2B allows for detailed biochemical and functional analyses, facilitating the exploration of its therapeutic applications, such as in regenerative medicine and cancer therapy. Understanding the structure-function relationship of WNT2B could lead to the development of targeted treatments that harness its signaling capabilities to influence cellular outcomes beneficially.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US