Analytical Data
-
Gene name
KISS1R
- Application
-
Alternative Names
KISS1R；AXOR12；GPR54；KiSS-1 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969F8
-
Expression Region
1-398aa
-
AA Sequence
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
-
Molecular Weight
42.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KISS1R, also known as the KISS1 receptor, plays a crucial role in the regulation of reproduction and the onset of puberty. It is a G protein-coupled receptor (GPCR) that is activated by kisspeptins, which are peptides derived from the KISS1 gene. The interaction between KISS1R and kisspeptins has been shown to stimulate the release of gonadotropin-releasing hormone (GnRH), thus initiating the reproductive hormonal cascade essential for sexual development and fertility. Disruption in KISS1R function or signaling can lead to various reproductive disorders, such as hypogonadotropic hypogonadism and precocious puberty. Given its significance in the reproductive axis, KISS1R has garnered attention in both basic research and clinical settings. The study of KISS1R and its ligand kisspeptin has implications for understanding the neuroendocrine regulation of reproduction, potential therapeutic targets for reproductive disorders, and insights into broader functions like metabolic regulation. Recombination protein studies of KISS1R allow researchers to explore its structure, binding properties, and downstream signaling pathways. This can enhance our understanding of receptor pharmacology and aid in the development of KISS1R-specific drugs, offering new therapeutic avenues for managing reproductive health issues. Additionally, understanding the functional dynamics of KISS1R contributes to the broader field of GPCR research, which is pivotal in pharmaceutical development due to the involvement of GPCRs in numerous physiological processes and their status as key drug targets.
