Cat: PA1000-8986

Recombinant Human ProGRP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ProGRP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ProGRP;

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07492

  • Expression Region

    54-121aa

  • AA Sequence

    STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKD

  • Molecular Weight

    35.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ProGRP (pro-gastrin-releasing peptide) is a neuropeptide that has garnered significant attention due to its role as a biomarker in various malignancies, particularly lung cancer. It was initially identified as a precursor of gastrin-releasing peptide, a neurotransmitter involved in regulating gastric activities and neurogenic processes. Over the years, research has indicated that ProGRP levels are elevated in patients with small cell lung cancer (SCLC) and can be utilized as a diagnostic and prognostic marker. The interest in ProGRP stems from its potential to improve early detection of SCLC and to monitor treatment responses. Advances in biotechnology have enabled the development of sensitive assays to measure ProGRP levels in serum, thus facilitating its clinical application. Furthermore, the understanding of ProGRP's biological functions and molecular mechanisms continues to evolve, revealing its involvement in cellular signaling pathways that may contribute to tumor progression. As research progresses, ProGRP is being investigated not only for its diagnostic capabilities but also for its potential therapeutic implications, marking it as a critical focus in cancer research and personalized medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US