Cat: PA1000-184DB

Recombinant Human ANXA8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANXA8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ANXA8;ANX8;Annexin A8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13928

  • Expression Region

    1-327aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAWWKSWIEQEGVTVKSSSHFNPDPDAETL YKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELS GKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLRE IMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLAL QDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEKIANKSIED SIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNI VSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANXA8, or Annexin A8, is a member of the annexin protein family, characterized by its calcium-dependent phospholipid-binding properties. It plays crucial roles in various cellular processes, including membrane trafficking, signal transduction, cell proliferation, and apoptosis. The study of ANXA8 and its recombinant protein has garnered interest due to its potential implications in cancer biology and neurodegenerative diseases. Elevated levels of ANXA8 have been observed in certain cancer types, suggesting its role in tumorigenesis and progression. Furthermore, its involvement in apoptotic processes highlights its potential as a therapeutic target. The recombinant expression of ANXA8 provides an invaluable tool for investigating its biochemical functions and interactions within cellular pathways. By producing and characterizing ANXA8 in a controlled setting, researchers can ascertain its structural properties and functional mechanisms, ultimately contributing to the development of novel diagnostic and therapeutic strategies. This research not only enhances our understanding of annexin family proteins but also paves the way for exploring their roles in human disease, making ANXA8 a significant focus within the broader context of molecular and cellular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US