Analytical Data
-
Gene name
ANKRD1
- Application
-
Alternative Names
ANKRD1；C193；CARP；HA1A2；Ankyrin repeat domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15327
-
Expression Region
1-319aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMMVLKVEELVTGKKNGNGEAGEFLPED FRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQ RSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKA ALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGA QIEFRDMLESTAIHWASRGGNLDVLKLLLNKGAKISARDKLLSTALHVAV RTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGAD LNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANKRD1, also known as cardiac ankyrin repeat domain protein 1, is a critical regulator of cardiac development and function. Research on ANKRD1 has gained momentum due to its significant role in heart diseases, particularly in hypertrophic cardiomyopathy and heart failure. The protein is primarily expressed in the heart and is involved in various cellular processes, including transcriptional regulation, cellular signaling, and cytoskeletal organization. Its expression is tightly regulated during cardiac development and is downregulated in pathological conditions. Recent studies have highlighted the importance of ANKRD1 in myocardial remodeling and the response to stress, making it a potential biomarker for cardiac events. Moreover, understanding the molecular mechanisms governing ANKRD1 function may reveal novel therapeutic targets for treating heart diseases. Advances in recombinant protein technology have enabled the production of ANKRD1 in sufficient quantities for detailed functional studies. This allows researchers to investigate its interactions with other proteins and elucidate its role in cardiac physiology and pathology. By exploring the structure-function relationships of ANKRD1 through recombinant protein studies, scientists aim to provide insights that could lead to innovative strategies for cardiovascular intervention, contributing to improved diagnostic and treatment options for heart-related disorders.
