Analytical Data
-
Gene name
ANKRA2
- Application
-
Alternative Names
ANKRA2；ANKRA；Ankyrin repeat family A Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H9E1
-
Expression Region
1-313aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMDTSTNLDIGAQLIVEECPSTYSLTGM PDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDS KNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIK QSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINH TDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGY TDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIE TDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIKE
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANKRA2, a member of the ankyrin repeat-containing protein family, has attracted attention due to its crucial role in cellular processes such as signal transduction, transcription regulation, and cell cycle control. Recent studies have highlighted its involvement in cancer progression and immune responses, as ANKRA2 has been implicated in modulating various signaling pathways that impact cell proliferation and differentiation. The exploration of ANKRA2 recombinant protein offers significant potential for understanding its functional mechanisms and interactions at the molecular level. By producing and studying this protein in a recombinant form, researchers aim to elucidate its biological roles and assess its potential as a therapeutic target. This research is particularly relevant in the context of cancer biology, where manipulating ANKRA2 activity may provide novel avenues for treatment strategies. Additionally, the characterization of ANKRA2 interactions with other proteins can enhance our understanding of complex cellular networks and may contribute to the development of biomarkers for disease diagnosis and prognosis. Overall, the study of ANKRA2 recombinant protein is a promising area of investigation that holds the potential to uncover new insights into fundamental biological processes and therapeutic applications.
