Cat: PA1000-155DB

Recombinant Human ANGPTL7 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANGPTL7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ANGPTL7;CDT6;Angiopoietin-related Protein 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q969Q3

  • Expression Region

    1-346aa

  • AA Sequence

    MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVK ELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAES KYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPD DFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRG DFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLF LGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTD SNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANGPTL7, or angiopoietin-like protein 7, is a member of the angiopoietin-like family, which is known to play crucial roles in various physiological processes, including angiogenesis, metabolism, and inflammation. Recent studies have indicated that ANGPTL7 is involved in regulating lipid metabolism and may have implications in metabolic disorders such as obesity and type 2 diabetes. Research on ANGPTL7 has garnered attention due to its potential role in modulating energy homeostasis and the development of cardiovascular diseases. Furthermore, initial findings suggest that ANGPTL7 may interact with specific receptors in the vascular system, influencing endothelial function and promoting vascular health. Given the increasing prevalence of metabolic diseases globally, understanding the biological functions and mechanisms of action of ANGPTL7 could provide valuable insights for developing novel therapeutic strategies. The production and study of recombinant ANGPTL7 proteins are essential for elucidating their structural and functional characteristics, allowing researchers to explore their role in health and disease. By investigating the molecular pathways associated with ANGPTL7, scientists aim to uncover potential biomarkers for diseases and innovative targets for drug development, ultimately contributing to improved public health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US