Analytical Data
-
Gene name
AMT
- Application
-
Alternative Names
AMT;GCST;Aminomethyltransferase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48728
-
Expression Region
29-403aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSAQEVLRRTPLYDFHLAHGGKMVAFAGW SLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGD IAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLAL MQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFM TSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKL AGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGA KVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPS LKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AMT (Amino Acid Permease from Methylophilus methylotrophus) is a member of the amino acid transporter family that plays a crucial role in the transport of amino acids across cell membranes. The study of AMT recombinant proteins has garnered significant attention due to their potential applications in biotechnology and medicine. Understanding the structure and function of AMT can provide insights into amino acid metabolism, cellular communication, and nutrient uptake in organisms. Advances in genetic engineering techniques have facilitated the production of AMT as a recombinant protein, allowing researchers to investigate its properties in detail. This research is pivotal for several reasons: first, it can lead to the development of novel therapeutic strategies for metabolic disorders linked to amino acid transport; second, by elucidating the mechanisms of AMT, scientists can design more effective drug delivery systems; and finally, it contributes to the broader understanding of membrane transport proteins, which are essential for maintaining cellular homeostasis. The recombinant production of AMT not only aids in characterizing its functional properties but also opens avenues for engineering enhanced variants with improved transport capabilities. Thus, the study of AMT recombinant proteins stands at the intersection of fundamental research and practical applications, underscoring their importance in both academic and industrial contexts.











