Cat: PA1000-150DB

Recombinant Human AMT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AMT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AMT;GCST;Aminomethyltransferase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P48728

  • Expression Region

    29-403aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSAQEVLRRTPLYDFHLAHGGKMVAFAGW SLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGD IAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLAL MQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFM TSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKL AGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGA KVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPS LKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AMT (Amino Acid Permease from Methylophilus methylotrophus) is a member of the amino acid transporter family that plays a crucial role in the transport of amino acids across cell membranes. The study of AMT recombinant proteins has garnered significant attention due to their potential applications in biotechnology and medicine. Understanding the structure and function of AMT can provide insights into amino acid metabolism, cellular communication, and nutrient uptake in organisms. Advances in genetic engineering techniques have facilitated the production of AMT as a recombinant protein, allowing researchers to investigate its properties in detail. This research is pivotal for several reasons: first, it can lead to the development of novel therapeutic strategies for metabolic disorders linked to amino acid transport; second, by elucidating the mechanisms of AMT, scientists can design more effective drug delivery systems; and finally, it contributes to the broader understanding of membrane transport proteins, which are essential for maintaining cellular homeostasis. The recombinant production of AMT not only aids in characterizing its functional properties but also opens avenues for engineering enhanced variants with improved transport capabilities. Thus, the study of AMT recombinant proteins stands at the intersection of fundamental research and practical applications, underscoring their importance in both academic and industrial contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US