Cat: PA1000-147DB

Recombinant Human AMN Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AMN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AMN;Protein amnionless

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51645

  • Expression Region

    20-357aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSVSKLWVPNTDFDVAANWSQNRTPCAGG AVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDC GAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPP SASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPG ALSVGPEDCADPSGCVCGNAEAQPWICAALLQPLGGRCPQAACHSALRPQ GQCCDLCGAVVLLTHGPAFDLERYRARILDTFLGLPQYHGLQVAVSKVPR SSRLREADTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATM RESGAHVWGSS

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AMN (Amnion-derived Multilineage-Inducible) proteins are a class of proteins that have garnered attention due to their potential applications in regenerative medicine and tissue engineering. Derived from the amniotic membrane, these proteins exhibit unique properties, including anti-inflammatory effects and the ability to promote cell proliferation and differentiation. Research into AMN proteins began as scientists sought to harness the regenerative potential of amniotic tissues, which are rich in stem cells and growth factors. The interest in these proteins has expanded as studies have demonstrated their roles in modulating immune responses and supporting tissue repair in various models of injury and disease. Furthermore, AMN proteins have been explored for their possible use in treating conditions such as chronic wounds, cardiovascular diseases, and neurological disorders, where traditional therapies may fall short. Ongoing investigations aim to elucidate the molecular mechanisms underlying the beneficial effects of AMN proteins and to optimize their application in clinical settings. The growing body of literature indicates that AMN proteins may represent a promising frontier in the development of novel therapeutic strategies aimed at enhancing healing and tissue regeneration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US