Cat: PA1000-8967

Recombinant Human THBS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    THBS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    THBS1;TSP;TSP1;Thrombospondin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07996

  • Expression Region

    19-344aa

  • AA Sequence

    NRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIP PVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFS VVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLY IDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFV FGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQA ICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLC YHNGVQYRNNEEWTVDSCTECHCQNS

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Thrombospondin-1 (THBS1) is a glycoprotein involved in various biological processes, including cell adhesion, migration, and angiogenesis. It plays a critical role in the regulation of tissue repair and remodeling, as well as in the modulation of immune responses. Research has demonstrated that THBS1 can influence tumor growth and metastasis by regulating the tumor microenvironment and promoting the interactions between cancer cells and stromal components. In recent years, recombinant THBS1 protein has gained attention as a potential therapeutic agent and research tool, providing insights into its structural and functional properties. The development of recombinant THBS1 has enabled scientists to explore its therapeutic potential in diverse fields, such as cancer treatment, wound healing, and cardiovascular diseases. Various studies have focused on characterizing the recombinant protein's effects on cell signaling pathways and its interactions with other extracellular matrix components, further elucidating its multifaceted roles in health and disease. Understanding the mechanisms of THBS1-mediated signaling could pave the way for novel strategies in drug development and regenerative medicine, highlighting the importance of continuing research on this protein.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US