Cat: PA1000-146DB

Recombinant Human AMMECR1L Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AMMECR1L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AMMECR1L;AMMECR1-like Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q969S7

  • Expression Region

    1-310aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMGKRRCVPPLEPKLAAGCCGVKKPKLS GSGTHSHGNQSTTVPGSSSGPLQNHQHVDSSSGRENVSDLTLGPGNSPIT RMNPASGALSPLPRPNGTANTTKNLVVTAEMCCYCFDVLYCHLYGFPQPR LPRFTNDPYPLFVTWKTGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKD SRFPPLTREELPKLFCSVSLLTNFEDASDYLDWEVGVHGIRIEFINEKGV KRTATYLPEVAKEQDWDQIQTIDSLLRKGGFKAPITSEFRKTIKLTRYRS EKVTISYAEYIASRQHCFQNGTLHAPPLYNHYS

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AMMECR1L (AMME chromosomal region 1-like protein) is a relatively novel protein that has gained attention in the context of gene therapy and regenerative medicine. Its significance arises from its association with the AMME (Amegakaryocytic thrombocytopenia, Mongolian spot, and early tooth decay) syndrome, a genetic disorder affecting hemostasis and bone development. Studies have suggested that AMMECR1L plays a crucial role in cellular processes such as cell proliferation, differentiation, and apoptosis. Given its involvement in critical biological pathways, researchers are exploring the potential of AMMECR1L as a therapeutic target for various conditions, including hematological disorders and bone regeneration. The recombinant version of AMMECR1L is being investigated for its biotechnological applications, focusing on its ability to modulate cellular functions and its potential as a biomarker for disease. Additionally, understanding the structure and function of AMMECR1L can provide insights into its mechanisms of action and its role in disease pathology, paving the way for novel therapeutic interventions. As research progresses, AMMECR1L is emerging as a candidate for innovative treatment strategies, underscoring the importance of studying its recombinant form to unlock its full therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US