Cat: PA1000-8964

Recombinant Human SRF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SRF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SRF;Serum response factor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11831

  • Expression Region

    406-508aa

  • AA Sequence

    HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVP QVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHST KSE

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SRF, or Serum Response Factor, is a crucial transcription factor that plays a significant role in regulating gene expression related to muscle development, cardiac function, and several other physiological processes. Understanding the biological mechanisms underlying SRF activity has implications for various fields, including developmental biology, cardiovascular research, and muscle physiology. Recent studies have shown that SRF is involved in various signaling pathways, responding to growth factors, stress, and mechanical stretch. Its ability to regulate genes associated with smooth muscle contraction and cellular growth makes it a potential therapeutic target for cardiovascular diseases. Moreover, SRF has been linked to important regulatory processes in stem cell differentiation and the response to injury. Research on recombinant SRF proteins is vital for elucidating the molecular mechanisms of its action and for developing potential therapies. By producing and characterizing SRF proteins, scientists aim to explore their functional roles in cellular contexts, investigate their interactions with other proteins, and identify specific binding partners. This research not only enhances our understanding of SRF's function in health and disease but also opens avenues for innovative treatments addressing various muscular and cardiovascular conditions. Overall, the study of SRF and its recombinant proteins provides valuable insights into critical biological processes and has the potential to contribute significantly to medical advancements.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US