Analytical Data
-
Gene name
SRF
- Application
-
Alternative Names
SRF;Serum response factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11831
-
Expression Region
406-508aa
-
AA Sequence
HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVP QVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHST KSE
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRF, or Serum Response Factor, is a crucial transcription factor that plays a significant role in regulating gene expression related to muscle development, cardiac function, and several other physiological processes. Understanding the biological mechanisms underlying SRF activity has implications for various fields, including developmental biology, cardiovascular research, and muscle physiology. Recent studies have shown that SRF is involved in various signaling pathways, responding to growth factors, stress, and mechanical stretch. Its ability to regulate genes associated with smooth muscle contraction and cellular growth makes it a potential therapeutic target for cardiovascular diseases. Moreover, SRF has been linked to important regulatory processes in stem cell differentiation and the response to injury. Research on recombinant SRF proteins is vital for elucidating the molecular mechanisms of its action and for developing potential therapies. By producing and characterizing SRF proteins, scientists aim to explore their functional roles in cellular contexts, investigate their interactions with other proteins, and identify specific binding partners. This research not only enhances our understanding of SRF's function in health and disease but also opens avenues for innovative treatments addressing various muscular and cardiovascular conditions. Overall, the study of SRF and its recombinant proteins provides valuable insights into critical biological processes and has the potential to contribute significantly to medical advancements.











