Analytical Data
-
Gene name
SAA2
- Application
-
Alternative Names
SAA2;Serum amyloid A-2 Protein
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05367
-
Expression Region
20-122aa
-
AA Sequence
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
-
Molecular Weight
15.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SAA2, or Serum Amyloid A2, is an acute-phase protein primarily produced by the liver in response to inflammation. It plays a critical role in the body’s immune response, serving as a biomarker for various inflammatory conditions and diseases, including infections, autoimmune disorders, and chronic inflammatory diseases. The study of SAA2 recombinant protein has gained considerable attention due to its potential applications in diagnostics and therapeutics. Understanding its structure and function can provide insights into its role in the inflammatory process and its involvement in amyloidosis, a condition where misfolded proteins accumulate in tissues, leading to organ dysfunction. Research has shown that SAA2 can modulate immune responses, influencing the activation and resolution of inflammation. Furthermore, recombinant SAA2 can serve as a valuable tool for investigating its biological functions in vitro and in vivo. Efforts to produce SAA2 in recombined forms allow for the investigation of its interactions with other proteins and cellular components, which may elucidate its mechanisms in health and disease. Overall, the exploration of SAA2 recombinant protein is crucial for advancing our understanding of inflammation and its systematic implications, paving the way for novel therapeutic strategies targeting inflammatory and amyloid-related conditions.











