Cat: PA1000-86DB

Recombinant Human AHCY Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AHCY

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AHCY;DCAL;IRBIT;XPVKONA;S-adenosylhomocysteine hydrolase-like Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23526

  • Expression Region

    1 -432aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSDKLPYKVADIGLAAWGRKALDIAENEMP GLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCN IFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILD DGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQ ALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCID IILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRL KNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYP VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY RY

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AHCY (Adenosylhomocysteinase) is an essential enzyme that catalyzes the hydrolysis of adenosylhomocysteine to adenosine and homocysteine, playing a critical role in the methionine cycle and regulating the levels of S-adenosylmethionine (SAM) and S-adenosylhomocysteine (SAH). Dysregulation of AHCY has been implicated in various pathological conditions including cardiovascular diseases, neurological disorders, and certain cancers. Research on recombinant AHCY protein has gained momentum in recent years, as it provides a valuable tool for elucidating the structure-function relationship of the enzyme, exploring its metabolic pathways, and investigating its potential as a therapeutic target. The production of recombinant AHCY not only allows for detailed biochemical characterization but also facilitates the development of inhibitors that may have therapeutic applications in treating diseases associated with altered homocysteine metabolism. Furthermore, understanding the dynamics of AHCY activity and its regulation can lead to insights into cellular methylation processes, which are pivotal for gene expression and epigenetic modifications. As such, AHCY remains a significant focus of biochemical research, with ongoing studies aimed at optimizing its expression and purification methods, improving assay techniques, and exploring its interactions with other biomolecules within the context of metabolic and signaling pathways. Through these investigations, researchers hope to uncover new avenues for clinical interventions and advance knowledge in the fields of molecular biology and pharmacology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US