Analytical Data
-
Gene name
AGR3
- Application
-
Alternative Names
AGR3;BCMP11;PDIA18;Anterior gradient Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TD06
-
Expression Region
22 -166aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQT YEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIM LNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRD LPLLIENMKKALRLIQSEL
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AGR3 (Anterior Gradient-3) is a protein that has garnered significant attention in recent years due to its potential roles in various biological processes, particularly in cancer biology. Initially identified as a developmentally regulated protein, AGR3 has been implicated in the progression of several tumors, including breast and colon cancers. It is believed to function as a co-chaperone in protein folding, assisting in the stabilization of client proteins, which may contribute to cancer cell survival and proliferation. Research has shown that AGR3 expression is often upregulated in cancerous tissues, correlating with increased tumor aggressiveness and poor patient prognosis. This has sparked interest in AGR3 as a potential biomarker for cancer diagnosis and prognosis, as well as a novel therapeutic target. Recent studies involving the recombinant expression of AGR3 protein have aimed to elucidate its structural properties and functional mechanisms, providing insights into its role in oncogenic processes. The ongoing investigation into AGR3's molecular pathways and interactions with other cellular components holds promise for developing targeted therapies and improving treatment outcomes for cancer patients. As a result, understanding the implications of AGR3 in various cancer types can lead to innovative approaches in cancer management and highlight the significance of this protein in the broader context of tumor biology.











