Analytical Data
-
Gene name
EAAT5
- Application
-
Alternative Names
EAAT5；EAAT5；Excitatory amino acid transporter 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00341
-
Expression Region
1-560aa
-
AA Sequence
MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRMLKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAAQKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMGDSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTVVCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKDFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV
-
Molecular Weight
60.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EAAT5 (excitatory amino acid transporter 5) is a member of the sodium-dependent glutamate transporter family, primarily expressed in the retina, where it plays a crucial role in the regulation of glutamate levels in the synaptic cleft. This transporter is vital for visual signaling, as it helps to terminate glutamate neurotransmission and prevents excitotoxicity, which can lead to neurodegenerative conditions. Research into the recombinant protein of EAAT5 aims to elucidate its structure-function relationship, kinetics, and regulatory mechanisms, essential for understanding its role in phototransduction and potential involvement in retinal pathologies. Additionally, investigating the recombinant form of EAAT5 allows for the assessment of its interaction with pharmacological agents, which could lead to the development of therapeutic strategies for conditions such as retinal degeneration, epilepsy, and schizophrenia, where glutamate signaling is disrupted. By analyzing the EAAT5 protein through various biochemical and biophysical methods, researchers hope to provide insights into its mechanism of action, paving the way for novel treatments that target glutamate homeostasis in the retina and other regions of the nervous system.
