Analytical Data
-
Gene name
IGF2R
- Application
-
Alternative Names
IGF2R;MPRI;Cation-independent mannose-6-phosphate receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11717
-
Expression Region
628-772aa
-
AA Sequence
LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
-
Molecular Weight
20.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IGF2R (Insulin-like Growth Factor 2 Receptor) is a critical component in the regulation of growth and development, primarily by mediating the actions of insulin-like growth factor 2 (IGF2). The receptor plays a vital role in cellular processes such as growth factor signaling, endocytosis, and the regulation of gene expression. Its involvement in various physiological conditions, including fetal development, metabolic disorders, and cancer, has spurred significant interest in its therapeutic potential. The interest in IGF2R as a target for drug development is heightened by findings that alterations in its expression or function are linked to various pathologies, including obesity, diabetes, and different types of cancer. Moreover, IGF2R exhibits an intricate relationship with other signaling pathways, suggesting that its modulation could have widespread implications for treatment strategies. Research on recombinant IGF2R protein offers promising avenues for exploring its structure-function relationships and developing potential biomarker applications. By producing recombinant IGF2R, researchers can investigate its binding properties, signaling mechanisms, and interactions with IGF2 and other ligands. This could lead to the development of novel therapeutic agents aimed at modulating IGF2R function to combat associated diseases. As such, the ongoing research into recombinant IGF2R protein is vital for elucidating its biological roles and therapeutic applications, potentially paving the way for innovative interventions in metabolic and oncological disorders.











