Cat: PA1000-8900

Recombinant Human ISR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ISR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ISR;Angiotensin-converting enzyme 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q758T2

  • Expression Region

    1-342aa

  • AA Sequence

    MSAWASQEAAKEEEAVGDFARMLERRDAGLLARVLSRAQTGPEAYVRGLWRAEVGLERWRLTRVLGCGSVACVFELGDGALALKVPTSRRKAPVLLHEVLIYSHLAQQAGGRLAERHVVPFHGVAAVTRREYRRLRGGEVVPALVLERMDTTLEAVHRRAAVSKGQWWRYARDLVAALQFLRESCVVHGDIKTANVLVRGQDAFLADFTSAAVCDAAPEPLTTTLEYCAPGLIGGGQPTHSTDVYAAGLCLLALITRFEPFRELSMMKSHSSAPTHSLHETQWLMNAISKGDPIKYNVLSQDLYDRWAEELHFLRRFFVPAAQDALSRWLAESNARVAEHAF

  • Molecular Weight

    37.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ISR (Integrated Stress Response) is a crucial cellular pathway that helps organisms adapt to various stress conditions, such as nutrient deprivation, oxidative stress, and viral infections. Research into ISR has gained significant attention due to its implications in health and disease, particularly in understanding how cells maintain homeostasis under stress. The ISR pathway is primarily mediated by a family of eIF2α kinases that modulate protein synthesis in response to stress signals, leading to the selective translation of stress-related mRNAs. In recent years, studies have illustrated the dual role of ISR in cellular survival and apoptosis, suggesting that the context of the stress response determines whether a cell will activate protective mechanisms or trigger cell death. Moreover, the dysregulation of ISR has been implicated in various diseases, including neurodegenerative disorders, cancer, and metabolic syndromes, making it a potential target for therapeutic interventions. Understanding ISR and its associated proteins is crucial for developing strategies to manipulate this pathway, aiming to enhance cellular resilience or combat pathological states. Researchers are now focusing on characterizing ISR-related proteins, including their structure, function, and interactions, as well as how these proteins can be harnessed or modulated in drug design. This line of inquiry not only advances the basic understanding of cellular stress responses but also paves the way for innovative treatments that can improve health outcomes by fine-tuning the ISR in various disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US