Analytical Data
-
Gene name
AckA
- Application
-
Alternative Names
ackA;Acetate kinase AckA
-
Species
Human
-
Source
Baculovirus
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A6A3
-
Expression Region
110-476aa
-
AA Sequence
GEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCW
-
Molecular Weight
68.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of AckA recombinant protein arises from its potential role in bacterial metabolism, specifically in the context of regulating energy production and stress response. AckA, or acetate kinase A, is an enzyme that catalyzes the reversible conversion of acetate and ATP to acetyl phosphate and ADP, an important reaction in various microorganisms. This protein is particularly significant in the metabolic pathways of bacteria that utilize acetate as a carbon source, influencing their growth under aerobic and anaerobic conditions. Recent research has highlighted the implications of AckA in understanding microbial adaptation, biofilm formation, and the development of targeted antibacterial therapies. The production of AckA as a recombinant protein allows for detailed studies of its structure-function relationship, enzymatic activity, and the effects of post-translational modifications. By using techniques such as cloning and expression systems, researchers aim to characterize the functional capabilities of AckA, providing insight into its role in cellular regulation and metabolism. This foundational knowledge could pave the way for innovative approaches in biotechnology, including the development of biocatalysts for industrial processes that exploit acetate metabolism. Moreover, understanding AckA's mechanisms may contribute to advancements in medical microbiology, particularly in combating pathogenic bacteria that exhibit altered acetate utilization. Overall, the exploration of AckA recombinant protein holds promise for both scientific and practical applications, making it a compelling focus for ongoing research in microbial physiology and biochemistry.











