Cat: PA1000-35DB

Recombinant Human FGF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FGF1;FGFA;Fibroblast growth factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05230

  • Expression Region

    16-155aa

  • AA Sequence

    MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAE SVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYIS KKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

  • Molecular Weight

    16 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast growth factor 1 (FGF1) is a key member of the fibroblast growth factor family, known for its crucial role in various biological processes, including cell proliferation, differentiation, and angiogenesis. With its ability to promote wound healing and tissue regeneration, FGF1 has garnered significant attention in biomedical research and therapeutic development. Notably, studies have demonstrated its involvement in metabolic regulation, highlighting its potential in treating conditions such as obesity and diabetes. The recombinant protein form of FGF1 offers a promising avenue for exploring its therapeutic applications. Researchers have focused on optimizing its expression and purification to better understand its functional properties and mechanisms of action. Additionally, advancements in biotechnological methods have facilitated the production of recombinant FGF1 in sufficient quantities for preclinical and clinical research. Understanding the structure-function relationship of FGF1, as well as its interactions with specific receptors, is essential in designing effective interventions targeting various diseases. Thus, the ongoing investigation into FGF1 recombinant protein not only deepens our knowledge of growth factor biology but also paves the way for potential novel treatments in regenerative medicine and metabolic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US