Cat: PA1000-26DB

Recombinant Human ACADM Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACADM

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACADM;Medium-chain specific acyl-CoA dehydrogenase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11310

  • Expression Region

    26-421aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMKANRQREPGLGFSFEFTEQQKEFQATARK FAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFD ACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPL MCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLL ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFED VKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYAL ERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYA SIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTS QIQRLIVAREHIDKYKN

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of recombinant ACADM (acyl-CoA dehydrogenase, medium-chain) protein is crucial due to its role in fatty acid metabolism, particularly in the catabolism of medium-chain fatty acids. ACADM is a key enzyme in the mitochondrial oxidation pathway, and mutations in the ACADM gene can lead to medium-chain acyl-CoA dehydrogenase deficiency (MCADD), a metabolic disorder associated with severe hypoglycemia and a risk of serious health complications, particularly in newborns and young children. The production of recombinant ACADM proteins allows researchers to better understand the enzyme's structure and function, investigate its interaction with various substrates, and explore the biochemical mechanisms underlying MCADD. Moreover, obtaining functional recombinant ACADM provides a platform for developing therapeutic strategies, including enzyme replacement therapies or small molecule drugs, aimed at treating the metabolic disruptions caused by ACADM deficiencies. As such, advances in the recombinant production and characterization of ACADM protein not only contribute to our fundamental understanding of metabolic pathways but also hold potential for translation into clinical applications that can improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US